Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646174.1 | 3prime_partial | 171 | 1-513(+) |
Amino Acid sequence : | |||
MASLPHTLTTNIVSSNSSSSSSCSLFHPKTSQVNLSGKQIRQRRLVVPRNVTCSSNHKSRENSSSNSINNHHEEYPNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCG PADLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKY | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 18,369.565 | ||
Theoretical pI: | 9.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 56.264 | ||
aromaticity | 0.047 | ||
GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.363 | ||
sheet | 0.222 |