Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646177.1	internal	150	1-450(+)
Amino Acid sequence :
AAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSE SGWPSAGGTATSIDNARTYNQNLINHVRNG
Physicochemical properties
Number of amino acids:		150
Molecular weight:		16,344.124
Theoretical pI:		5.727
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17420 17420
Instability index:		35.628
aromaticity		0.107
GRAVY		-0.127
Secondary Structure Fraction
Helix		0.340
turn		0.333
sheet		0.180