Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646178.1 | internal | 195 | 3-587(+) |
Amino Acid sequence : | |||
IHFSIPKDNPSDKDINQGILVVFNLDFSISNNELCQIFGVYGEIKQISENCQKHQHKFIEFYDVRAAEAALHALNRSEIAGKRIKVELSHPGSTRCLMQQASANQDESLESFVISSCMEN EESPGLNSAIKVPVSPLVENEFHGGFSPSVPECVSSGRVAKISDQCGLAEPSQGLGQLEFSLQQMPIFHPHSLPD | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,450.872 | ||
Theoretical pI: | 5.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 53.859 | ||
aromaticity | 0.067 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.303 | ||
sheet | 0.236 |