Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646196.1 | 5prime_partial | 228 | 3-689(+) |
Amino Acid sequence : | |||
HLITLTVVCCMLSSVLLASMRGALAVDYQVTNRATGTQGGDRFTNEIGVEYSRQTLQSAASFIWQTFQQNTEADRKNVPSVSLFIDNMEGVAYASNNEIHVSANYIAGYSGDVKREITGV LYHESTHIWQWDGNRQAPGGLIEGIADYVRLKAGYAPSHWVQPGGGDRWDQGYDVTARFLDYCNSLKDGFVAELNSKMRNGYSNDFFMESLGKTVDQLWAEYKARYAN* | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,453.006 | ||
Theoretical pI: | 5.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52370 52495 | ||
Instability index: | 33.221 | ||
aromaticity | 0.118 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.246 | ||
sheet | 0.228 |