Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646197.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
TSVFLHQVQTMVTCSSCTSLLFPLLFIALAMSAHAAAPVEVRDIAGKQVQSGVDYYILPVTHRSGGGLTLGPNRMGTCPLNVVQEQHLKGLPLTFLPVNPKKGVIRVSTDLNIKFSAASI CVQTTLWKLAKYDETVKKYFVSTGGEEGNPGPATLSNWFKIERYEDDYKLVYCPTVCRFCKVICK | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 15,371.678 | ||
Theoretical pI: | 10.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 40.381 | ||
aromaticity | 0.104 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.209 | ||
sheet | 0.187 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646197.1 | 5prime_partial | 134 | 556-152(-) |
Amino Acid sequence : | |||
LANNFAKPTHRRTVNKLVVIFVSLYFKPIAQSSRTRIPFFPAGTHKIFLHCFIVLRELPQRCLYANTCGRELDVEISRNTNDSFLRVHGKECKWQSFKVLFLHNVKWASAHSVRTKSKAT STAMSHGQDVVINT* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,371.678 | ||
Theoretical pI: | 10.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 40.381 | ||
aromaticity | 0.104 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.209 | ||
sheet | 0.187 |