Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646202.1 | internal | 144 | 432-1(-) |
Amino Acid sequence : | |||
DKKHSIPQFILIQHSVKLIPCFYNSIPIIAVNNKDETLCILEIVAPQWSDLVLATNIPDSKADILVLHCLNIETDGWDSGHDLAKLQLVQDRRFTGSIESDHQNPHLLLREQSTEELRKR QPHCCYGSMDPADFLENSLLPYES | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 14,234.381 | ||
Theoretical pI: | 6.736 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 23.850 | ||
aromaticity | 0.098 | ||
GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.146 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646202.1 | 3prime_partial | 123 | 64-432(+) |
Amino Acid sequence : | |||
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLV | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 14,234.381 | ||
Theoretical pI: | 6.736 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 23.850 | ||
aromaticity | 0.098 | ||
GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.146 | ||
sheet | 0.260 |