Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646209.1 | internal | 214 | 2-643(+) |
Amino Acid sequence : | |||
QNLLKPSFSSSPFTEKHSIERYKRDSWLYQDHPLLQTSCSLSYDSSSIRDNDIALQLPELKKLLQVLREKRVKEESENGHKRFGPGNVFLVGTGPGDPELLTLKALKAIENADLLLYDRL VSNEVLNLVSPDARLLYVVKTAGYHSRTQEEIHELLLSFAEAGATVVRLKGGDPLVFGRGGEEMDFLQQQGIQVKVIPGITAASGIAAELGIPL | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 12,262.316 | ||
Theoretical pI: | 10.305 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 61.041 | ||
aromaticity | 0.094 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.377 | ||
turn | 0.264 | ||
sheet | 0.170 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646209.1 | complete | 106 | 460-140(-) |
Amino Acid sequence : | |||
MNLLLSSAMVPSSLDHIKKPGVRAHQIQNLIRDQTIVQQKISIFNCFQSFQSQQLRISRSCPNQKHIPGPKSLVPIFTFLLNPLLPQYLKQFLQFWKLQSYVIVSN* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,262.316 | ||
Theoretical pI: | 10.305 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 61.041 | ||
aromaticity | 0.094 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.377 | ||
turn | 0.264 | ||
sheet | 0.170 |