Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646219.1 | 5prime_partial | 197 | 1-594(+) |
Amino Acid sequence : | |||
KTSASSMLLFLCILVISFSWATSSSIATERLLQCLVVPSGPAIPVYTPNNSSYNSILQSKIQIVRFASSDIPKPRLIITPLHESHVQKAVICCRKHGFQMRTRSGGHDYEGLSYTTYNGI VPFVVLDLFNLQTISVDVEDGTAWVQAGATLAQVYYKIADKSSTYGFPAGICPTVGVGGHFSGGGYGTLMRKIWPFC* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 21,418.484 | ||
Theoretical pI: | 8.921 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
Instability index: | 28.317 | ||
aromaticity | 0.107 | ||
GRAVY | 0.214 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.279 | ||
sheet | 0.178 |