Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646220.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
RPRLDVAASDSLASHQPPSFPIPDIAHKLPSEPTGNLQSGSAPFSTQVGGYYGFPGSGTSKKIEIPNGKVGVIIGKSGETIKQLQLQSGAKIQVTKDSEADLYSQTRDVELVGTPEQISR AEELIKNVIAETDAGGSGSSAARGFNSATPGAEQFVMKVPNNKVAVIIGKGGENIKSMQSRTGARIQVIPLHLPPGDTSTERNVYINGTNEQIEAAKVLLNEVISESRVRNPSSQQGYRP PANWGPS | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 26,081.846 | ||
Theoretical pI: | 8.090 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 42.994 | ||
aromaticity | 0.045 | ||
GRAVY | -0.477 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.348 | ||
sheet | 0.202 |