Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646235.1	internal	129	2-388(+)
Amino Acid sequence :
ILLVLCVIVGGATAQSANNVRATYHNYNPASINWDYLRASVYCATWDANKPIEWRRQYGWTAFCGPVGPRGQASCGRCLRVTNTRTGDQATVRIVDQCSNGGLDLDVNVFRQIDRDGNGI FQGHPYCQL
Physicochemical properties
Number of amino acids:		129
Molecular weight:		14,282.905
Theoretical pI:		8.553
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30940 31315
Instability index:		21.164
aromaticity		0.101
GRAVY		-0.269
Secondary Structure Fraction
Helix		0.302
turn		0.256
sheet		0.155