Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646239.1	internal	252	3-758(+)
Amino Acid sequence :
SNLPPPQEVVALYRQRNIGRVRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVS TAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTAT SIDNARTYNQNL
Physicochemical properties
Number of amino acids:		252
Molecular weight:		27,816.113
Theoretical pI:		7.821
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31860 31860
Instability index:		48.633
aromaticity		0.099
GRAVY		-0.167
Secondary Structure Fraction
Helix		0.349
turn		0.317
sheet		0.194