Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646239.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
SNLPPPQEVVALYRQRNIGRVRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVS TAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTAT SIDNARTYNQNL | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 27,816.113 | ||
Theoretical pI: | 7.821 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 48.633 | ||
aromaticity | 0.099 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.317 | ||
sheet | 0.194 |