Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646249.1 | internal | 161 | 3-485(+) |
Amino Acid sequence : | |||
IKRNQSGRGLQYNQIWSFPPSLDLSSNMLSGPIWPEFGKLIKLIVLDLKSNHLSGSIPYQLSGMRNLENLDLSHNNLSGTIPPSLTSLSFLSKFSVAFNNLVGKIPMGGQFGTFPSSSFE GNKDLCTEHSCYSPQAPPVRFNPKSSNKIRRNKGVVIGMGV | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 17,639.042 | ||
Theoretical pI: | 9.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 44.558 | ||
aromaticity | 0.087 | ||
GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.410 | ||
sheet | 0.180 |