Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646254.1	internal	212	2-637(+)
Amino Acid sequence :
VTYLTTVIIITSFGLFVLSFYYVLWKAIRTGNKRNCSNPKAPEAAGGWPILGHLHLFRGQGLLLHKIFGAMAEKHGPAFTIRLGMRPALVVSNWEVAKECFTANDRALASRPTSLALKIM GYNNSLFAFAPYGQYWRELRKIVMHQLLSSRRLELLKNVWLSEIDIWIKGLYENSLVNKVVDMKQWFGELMMNIVVRLVAGKRSFGKIREGD
Physicochemical properties
Number of amino acids:		212
Molecular weight:		24,160.220
Theoretical pI:		10.043
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		48930 49055
Instability index:		35.522
aromaticity		0.118
GRAVY		0.108
Secondary Structure Fraction
Helix		0.382
turn		0.222
sheet		0.283