Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646262.1	internal	230	1-690(+)
Amino Acid sequence :
SFSSTDLSIAADVLTIAMDLAPEELQFLTIQDILKESVTIPKQSSRTFSLITLTLIFPLSFAILAHSIFTHPLLHKIESQSPSNPRIHHEITLLFTYQFIYLIFLFIFSLLSTAAVVFAV ASLYTSKPVSFTSTISAIPRAFKRLFITFLYVFLLMTVYNIIFVSSVAFLLFALQMNSTFLLFLSIAVILVLFLVVHVYITALWHLASVVSVLEPVYGLAAMRKSRELLR
Physicochemical properties
Number of amino acids:		230
Molecular weight:		17,224.984
Theoretical pI:		4.598
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		81.878
aromaticity		0.041
GRAVY		-1.788
Secondary Structure Fraction
Helix		0.156
turn		0.245
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646262.1	5prime_partial	147	690-247(-)
Amino Acid sequence :
SQQLPALPHRRKTINRFKNRYHTGEMPQRRDINMNNQKQYQNDSNREEKQKRTVHLQREEQERYRRHEDDVVNRHEQKYIEESDEESLEGARDGGDCGGERNGLGSIEGSDGEDDSSSGE QGEDEEEDEIDELIGEEESDFMVDSRV*
Physicochemical properties
Number of amino acids:		147
Molecular weight:		17,224.984
Theoretical pI:		4.598
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		81.878
aromaticity		0.041
GRAVY		-1.788
Secondary Structure Fraction
Helix		0.156
turn		0.245
sheet		0.252