Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646262.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
SFSSTDLSIAADVLTIAMDLAPEELQFLTIQDILKESVTIPKQSSRTFSLITLTLIFPLSFAILAHSIFTHPLLHKIESQSPSNPRIHHEITLLFTYQFIYLIFLFIFSLLSTAAVVFAV ASLYTSKPVSFTSTISAIPRAFKRLFITFLYVFLLMTVYNIIFVSSVAFLLFALQMNSTFLLFLSIAVILVLFLVVHVYITALWHLASVVSVLEPVYGLAAMRKSRELLR | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 17,224.984 | ||
Theoretical pI: | 4.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 81.878 | ||
aromaticity | 0.041 | ||
GRAVY | -1.788 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.245 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646262.1 | 5prime_partial | 147 | 690-247(-) |
Amino Acid sequence : | |||
SQQLPALPHRRKTINRFKNRYHTGEMPQRRDINMNNQKQYQNDSNREEKQKRTVHLQREEQERYRRHEDDVVNRHEQKYIEESDEESLEGARDGGDCGGERNGLGSIEGSDGEDDSSSGE QGEDEEEDEIDELIGEEESDFMVDSRV* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 17,224.984 | ||
Theoretical pI: | 4.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 81.878 | ||
aromaticity | 0.041 | ||
GRAVY | -1.788 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.245 | ||
sheet | 0.252 |