Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646267.1 | 5prime_partial | 245 | 1-738(+) |
Amino Acid sequence : | |||
LHIFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYI AVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLV YRNLF* | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 27,299.037 | ||
Theoretical pI: | 9.515 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24870 24870 | ||
Instability index: | 49.258 | ||
aromaticity | 0.102 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.294 | ||
sheet | 0.204 |