Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646270.1	internal	222	3-668(+)
Amino Acid sequence :
SASSMLLFLCILVISFSWAASSSIATERLLQCLAVPSGPAIPVYTPNNSSYNSILQSKIQIVRFASSGIPKPRLIITPLHESHVQKAVICCRKHGFQMRTRSGGHDYEGLSYTTYNDIIP FVVLDLFNLQTISVDVEDGTAWVQAGATLAQVYYKIADKTSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNVDGKNFEQRFYGGRSYF
Physicochemical properties
Number of amino acids:		222
Molecular weight:		24,166.347
Theoretical pI:		8.780
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28880 29130
Instability index:		27.489
aromaticity		0.113
GRAVY		0.112
Secondary Structure Fraction
Helix		0.347
turn		0.279
sheet		0.185