Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646273.1 | internal | 262 | 1-786(+) |
Amino Acid sequence : | |||
EEAPQEDAKPIGGVIGVSGRGRGKRNHYHAFEYDGNRFELEDPVLLTPEDTGQKPYVAIIKDVSQTSSGTMMVTGQWFYRPEEAEKRGGGSWQARDTRELFYSFHRDEVPAESVMHKCVV HFVPLNKQLPRRQEHPGFIVQKVYDTVEKKLWKLTDKDYEDKKQHEIDLLVEKTRKRLGELPDVEIEETTGDQEDQLKTKRILRRKNMPPLDVTREDDLARSEQHLAVDTPGSGEVTEFY IILANFKALTRDNVRDKWLEKL | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 30,375.801 | ||
Theoretical pI: | 5.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 33920 | ||
Instability index: | 53.653 | ||
aromaticity | 0.080 | ||
GRAVY | -0.893 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.179 | ||
sheet | 0.244 |