Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646278.1 | complete | 215 | 21-668(+) |
Amino Acid sequence : | |||
MEYEGIYGQVQRPRYDCLLFDLDDTLYPLSSGLAEECRKNIGDYMVEKLGIEESKIPDMCNLLYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYGNVKPDPLLRNLLQSLPIRKVIFT NADVIHAEKVLSKLGLEGCFEGIICFEALNANTTNDDDEEESAFESTRSINSTTEPFDIIGHFSKPNDVSLLPKTPISCKPSEASFEQALKIANI* | |||
Physicochemical properties | |||
Number of amino acids: | 215 | ||
Molecular weight: | 10,623.171 | ||
Theoretical pI: | 8.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 71.682 | ||
aromaticity | 0.050 | ||
GRAVY | 0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.310 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646278.1 | 5prime_partial | 100 | 697-395(-) |
Amino Acid sequence : | |||
VIEKQTFSQRQILAILRACSKEASDGLQEIGVFGSRETSFGLEKCPIMSKGSVVELILLVLSNADSSSSSSLVVFALSASKQMIPSKQPSKPSLLSTFSA* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,623.171 | ||
Theoretical pI: | 8.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 71.682 | ||
aromaticity | 0.050 | ||
GRAVY | 0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.310 | ||
sheet | 0.270 |