Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646281.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
PGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPN MKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTA | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,081.497 | ||
Theoretical pI: | 6.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27390 | ||
Instability index: | 39.268 | ||
aromaticity | 0.120 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.317 | ||
sheet | 0.191 |