Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646284.1	internal	206	3-620(+)
Amino Acid sequence :
AEGHPLLQPAKRLTRPTITDTMASGIVQEVLPPVLDSTSEPPPLFDGTTRLYTSFICPYAQRVWITRNYKGLQDEIKLVPLDLGNRPSWYKEKVYPGNKVPVLEHNNEVKGESLDLIKYI DANFEGPSLLPDDPTKREFAEELFAYTDKFSGGVFGSLKGDGDMGAPFDHLESALQKFSDGPFFLGQFSLVDVAYAPFVERFQPLL
Physicochemical properties
Number of amino acids:		206
Molecular weight:		23,026.828
Theoretical pI:		4.839
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 22920
Instability index:		43.970
aromaticity		0.117
GRAVY		-0.314
Secondary Structure Fraction
Helix		0.330
turn		0.262
sheet		0.248