Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646291.1 | internal | 241 | 3-725(+) |
Amino Acid sequence : | |||
KTSASSMLLFLCILVISFSWATSSSIATERLLQCLVVPSGPAIPVYTPNNSSYNSILQSKIQIVRFASSDIPKPRLIITPLHESHVQKAVICCRKHGFQMRTRSGGHDYEGLSYTTYNGI VPFVVLDLFNLQTISVDVEDGTAWVQAGATLAQVYYKIADKSSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNIDGKILNKDSMGEELFWAIRGGGGASFGIVLSW K | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 26,008.595 | ||
Theoretical pI: | 8.776 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
Instability index: | 28.559 | ||
aromaticity | 0.100 | ||
GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.286 | ||
sheet | 0.191 |