Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646295.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
LVTTRSWSMFWYAPNDQCDEYRECGSYGICDANDSPVCNCVPGFAPKDEDAWNLRDGTGGCVLNKRFECGKDDGFLRLQRMKLPDTGKSFVNRSMSLEECKGTCKENCSCLAYSSADISN GGGGNGCVIWFDDLVDLRDYSEGGQDLYVRVAASVADGGNSG | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,572.487 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.835 | ||
aromaticity | 0.064 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.224 | ||
sheet | 0.141 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646295.1 | 5prime_partial | 156 | 486-16(-) |
Amino Acid sequence : | |||
ATVSTIGDRSRNTNVKILPALRVVPKINQIIKPNHTTITTAAITYIGTRISQTRTILFASPFTFFQTHASIHEALPSIWQFHPLKPQKPIVFPTLESLIQHTPTSPVSQVPSIFIFRRKA RHAVTNRRIIRITNPITPTLSVLIALIIRRVPKHTP* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,572.487 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 43.835 | ||
aromaticity | 0.064 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.224 | ||
sheet | 0.141 |