Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646315.1 | 3prime_partial | 217 | 133-783(+) |
Amino Acid sequence : | |||
MMVSHLEWRMVSLAILLLLVPRFPATSQVHLANEKRVKSAVFLSPMFVLGPGSVENKYYYNIGFPRGHIFLKEFDAEVIDEEGNPVPLHETYLHHWVVERYYALRDVDISKERGDRKLNR PKILSARNSGVCDDNTLGQYFGLGSETRKTATYVPDPYGIEVGNPAIIPDGYEQRWLLNVHAIDTRGVEDPLGCTECRCDLYNITKDESGRPLSTGY | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 24,660.770 | ||
Theoretical pI: | 5.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
Instability index: | 40.874 | ||
aromaticity | 0.101 | ||
GRAVY | -0.333 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.244 | ||
sheet | 0.240 |