Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646330.1	3prime_partial	146	162-599(+)
Amino Acid sequence :
MGIRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRNTIIKHKMVDQIKREISIMKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVQHGRLSESESRRYFQQLIDGV DYCHSKGVYHRDLKPENLLLDSQGNL
Physicochemical properties
Number of amino acids:		146
Molecular weight:		13,781.823
Theoretical pI:		8.824
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		33.529
aromaticity		0.151
GRAVY		0.028
Secondary Structure Fraction
Helix		0.387
turn		0.227
sheet		0.235

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646330.1	3prime_partial	119	359-3(-)
Amino Acid sequence :
MPDKFHYGNFPLYLVDHFVLDDGVAVEHFHGDTLTGLRVLRELHLREGSFSDRPSYLVLPYLSNPHCLFFLVSAIPLPASPTFHTLKTAKNFHTLKSSHHRKMIKAPFFFLFLRFDSIP
Physicochemical properties
Number of amino acids:		119
Molecular weight:		13,781.823
Theoretical pI:		8.824
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		33.529
aromaticity		0.151
GRAVY		0.028
Secondary Structure Fraction
Helix		0.387
turn		0.227
sheet		0.235