Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646331.1 | 5prime_partial | 235 | 1-708(+) |
Amino Acid sequence : | |||
FILIFPTKIMIITFPSFLIYSITLSSFLFCVANAATFEVTNNCGNPVWAAAVPGGGRQLNQGETWRFDVNPGTTQARIWGRTGCNFDGNGRGRCQTGDCNGLLQCEAYGQPPNTLAEYAL NQFGNMDFFDISLVDGFNIPMEFSPTTGNCRGIKCNADINGQCPNELKADGGCNNPCTVFKTDEYCCNSGNCGPTPLSKFFKERCPDAYSYPKDDPTSTFTCPAGTNYKVVFCPA* | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 25,570.578 | ||
Theoretical pI: | 4.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27930 | ||
Instability index: | 15.390 | ||
aromaticity | 0.123 | ||
GRAVY | -0.207 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.315 | ||
sheet | 0.162 |