Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646332.1 | 5prime_partial | 162 | 2-490(+) |
Amino Acid sequence : | |||
FLGKGHDKAADWWSVGVLLFEMLTGKPPFIGGNRQKIQQKIIKDKIKLPAFLSSEAHSLLKGLLQKEANKRLGSGSGGSDEIKLHKWFKSINWKKLENREIKPSFCPEVAGIHCTSNFEE RWTKMPLVDSPASSPAACDTSFKGFSYVRPAASFLQRNGSPQ* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,030.577 | ||
Theoretical pI: | 9.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 49.288 | ||
aromaticity | 0.099 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.290 | ||
sheet | 0.228 |