Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646342.1 | 3prime_partial | 233 | 31-729(+) |
Amino Acid sequence : | |||
MYSSGTDSVLASSTVADVVLIPTTFVWPYGGRRVFLSGSFTGWSEHLPMSPVEGCPTVFQAIYNLTPGYHQFKFFVDGEWKHDEHQHCVASNYGIVNTILITRDLDPVPLFCQEPDSVPA IFNPEAPGLRSNMDVDNDAFQRVVTLSDGTLSEVVHSISEADLQISRHRISVFLSRHTAYELLPESGKVIALDVNLPVKQAFHILYEQGISLAPLWDFSMGQFVGILSALDFI | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,847.983 | ||
Theoretical pI: | 4.813 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
Instability index: | 39.964 | ||
aromaticity | 0.112 | ||
GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.258 | ||
sheet | 0.215 |