Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646343.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
NIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSR GVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHV RNGTPKRPGRPIETYIFAMFNEDRKSPEF | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 29,930.479 | ||
Theoretical pI: | 8.742 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 47.445 | ||
aromaticity | 0.104 | ||
GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.312 | ||
sheet | 0.190 |