Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646347.1	internal	262	3-788(+)
Amino Acid sequence :
CLQIFVVMANLFKKLERRVRVSEAGKLNFSTSSSSSSSAVEQKSGKAANLFSAINQALHIALETDPRAYVFGEDVGFGGVFRCTTGLADRFGRSRVFNTPLCEQGIVGFGIGLAAMGNRA IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPKQAKGLLLSCIRDPNPTIFFEPKWLYRLAVEEVPEGDYMLPLSQA EVIRQGSDITLVGWGAQLAIME
Physicochemical properties
Number of amino acids:		262
Molecular weight:		28,618.444
Theoretical pI:		8.535
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21805
Instability index:		45.060
aromaticity		0.107
GRAVY		0.016
Secondary Structure Fraction
Helix		0.321
turn		0.263
sheet		0.248