Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646349.1	internal	227	1-681(+)
Amino Acid sequence :
ATPPSSGFNVSDEKCSTITSSTRHDSSPNLHAKTYYMHVKSMKEQQDTRLLPSNNNVTCEGLTPSSSFSGFNSTNTVKSAQRRKADSIKEAGHFLLFTKTLLATEIESIMFQVAMCRIRH MLLSSSNQVPTGLSRLTASMVLDPLPGDPGPMQDRSPSKFEVKKKETIPVRIAGDIDVGMLDGPLSAPIGVWRTVGVSKGAKPTSSLSVENNTSYHGSFNDENMVSY
Physicochemical properties
Number of amino acids:		227
Molecular weight:		24,659.605
Theoretical pI:		8.758
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11585
Instability index:		42.411
aromaticity		0.057
GRAVY		-0.422
Secondary Structure Fraction
Helix		0.238
turn		0.326
sheet		0.207