Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646355.1 | internal | 275 | 1-825(+) |
Amino Acid sequence : | |||
SRFAFSSRLLSLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE | |||
Physicochemical properties | |||
Number of amino acids: | 275 | ||
Molecular weight: | 30,838.074 | ||
Theoretical pI: | 8.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 28.769 | ||
aromaticity | 0.044 | ||
GRAVY | -0.402 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.171 | ||
sheet | 0.236 |