Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646359.1	complete	230	66-758(+)
Amino Acid sequence :
MAHLITLTVVCCMLSSVLLASMRGALAVDYQVTNRATGTQGGDRFTNEIGVEYSRQTLQSAASFIWQTFQQNTEADRKNVPSVSLFIDNMEGVAYASNNEIHVSANYIAGYSGDVKREIT GVLYHESTHIWQWDGNRQAPGGLIEGIADYVRLKAGYAPSHWVQPGGGDRWDQGYDVTARFLDYCNSLKDGFVAELNSKMRNGYSNDFFMESLGKTVDQLWAEYKARYAN*
Physicochemical properties
Number of amino acids:		230
Molecular weight:		25,655.280
Theoretical pI:		5.340
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		52370 52495
Instability index:		33.187
aromaticity		0.117
GRAVY		-0.345
Secondary Structure Fraction
Helix		0.304
turn		0.243
sheet		0.235