Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646359.1 | complete | 230 | 66-758(+) |
Amino Acid sequence : | |||
MAHLITLTVVCCMLSSVLLASMRGALAVDYQVTNRATGTQGGDRFTNEIGVEYSRQTLQSAASFIWQTFQQNTEADRKNVPSVSLFIDNMEGVAYASNNEIHVSANYIAGYSGDVKREIT GVLYHESTHIWQWDGNRQAPGGLIEGIADYVRLKAGYAPSHWVQPGGGDRWDQGYDVTARFLDYCNSLKDGFVAELNSKMRNGYSNDFFMESLGKTVDQLWAEYKARYAN* | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,655.280 | ||
Theoretical pI: | 5.340 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 52370 52495 | ||
Instability index: | 33.187 | ||
aromaticity | 0.117 | ||
GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.243 | ||
sheet | 0.235 |