Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646361.1 | internal | 276 | 1-828(+) |
Amino Acid sequence : | |||
PDKTIVTEPHHIWPSLTDDQWMKVEVALRDLILSDYAKKNNVNTSALTQSEIRDIILGAEITPPSQQRQQIAEIEKQAKEASQLTAVTTRTTNVHGDELIVTTTSPYEQAAFGSKTDWRV RAISATNLYLRVNHIYVNSEDIKETGFTYIMPKNILKKFICIADLRTQIAGYLYGISPPDNPQVKEIRCIAMPPQWGTHQQVHLPSALPEHDFLNDLEPLGWMHTQPNELPQLSPQDLTA HARVLENNKQWDGEKCIILTCSFTPGSCSLTAYKLT | |||
Physicochemical properties | |||
Number of amino acids: | 276 | ||
Molecular weight: | 31,155.019 | ||
Theoretical pI: | 5.719 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45170 | ||
Instability index: | 51.405 | ||
aromaticity | 0.069 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.210 | ||
sheet | 0.236 |