Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646374.1 | 3prime_partial | 235 | 91-795(+) |
Amino Acid sequence : | |||
MGNLLCCVQVDQSTVAIKERFGKFNEVLEPGCHCLPWIFGCQLAGHLSLRLQQLDVRCETKTKDNVFVNVVASVQYRALADKASDAFYKLSNTRTQIQAYVFDVIRASVPKLNLDDAFEQ KNEIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFSVNVPGTTAKDVMD | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 26,094.545 | ||
Theoretical pI: | 5.413 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 30.849 | ||
aromaticity | 0.064 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.166 | ||
sheet | 0.306 |