Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646388.1 | 3prime_partial | 247 | 86-826(+) |
Amino Acid sequence : | |||
MPEIEEQEHDVGANAALPVKNILFGKYELGKLLGCGAFAKVYHARNLQSGQSVAIKAISKQKVLKSGLTSHIKREICIMRRLRHPNIVKLIEVLASKTKIFFVMEFVKGGELFSKVAKGR FSEDLSRRYFQQLISAVEYCHSHGVFHRDLKPENLLLDENGDLKVSDFGLSAITDEQIRNDGLLHTLCGTPAYVAPEILAKQGYDGAKVDIWSCGVILFVMNAGYLPFNDPNLMVMYRKI YKGEFRC | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 11,049.204 | ||
Theoretical pI: | 10.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 59.469 | ||
aromaticity | 0.056 | ||
GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
Helix | 0.131 | ||
turn | 0.505 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646388.1 | 3prime_partial | 112 | 337-2(-) |
Amino Acid sequence : | |||
MAQATHDADFAFDVRSESGFEDFLLADGFNGDALAGLEVPGVVDLGKGAAAEEFPKLVFPEKDILDGKGCIGAHIMFLFLDLWHWDQRSTTLRFGQGDFVEKKRDSLFLRFF | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,049.204 | ||
Theoretical pI: | 10.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 59.469 | ||
aromaticity | 0.056 | ||
GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
Helix | 0.131 | ||
turn | 0.505 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646388.1 | complete | 107 | 111-434(+) |
Amino Acid sequence : | |||
MMWAPMQPFPSRISFSGNTSLGNSSAAAPLPRSTTPGTSNPAKASPLKPSASKKSSNPDSLLTSNAKSASCVACAIQTSSNSSKSWPPKPRSSSSWSSSKAENYSPK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,049.204 | ||
Theoretical pI: | 10.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 59.469 | ||
aromaticity | 0.056 | ||
GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
Helix | 0.131 | ||
turn | 0.505 | ||
sheet | 0.196 |