Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646390.1 | 3prime_partial | 236 | 82-789(+) |
Amino Acid sequence : | |||
MAARRISTLLSRSLNPSLRSLGKNSSWSRGGISRFGTAAVVEEPITPSVQVNHNQLLINGQFVDAASGRTFPTLDPRTGEIIAHVAEADSEDVNRAVSAARKAFDEGPWPKMSAYERSRV ISRFADLLEKHTEEIAALETWDNGKPYEQALRAEIPMVVRLFRYYAGWADKIHGLTVPADGAHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALATGNTIVLKTAEQTPLSALY | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 25,905.180 | ||
Theoretical pI: | 7.078 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
Instability index: | 34.766 | ||
aromaticity | 0.081 | ||
GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.242 | ||
sheet | 0.292 |