Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646409.1 | 3prime_partial | 259 | 24-800(+) |
Amino Acid sequence : | |||
MASPVEQIRKAQRAQGPATVLAIGTATPSNCVYQADYPDYYFRITKSEHMTELKEKFQRMCDKSMIRKRHLHLTEQILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAASKAIKEWGQ PKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSDSHLDSMVGQALFGDGAAAVIVGSDPDTSIERPLYQL VWTAQTILPDSEGAIDGHL | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 16,033.672 | ||
Theoretical pI: | 6.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 56.867 | ||
aromaticity | 0.048 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.279 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646409.1 | 5prime_partial | 147 | 800-357(-) |
Amino Acid sequence : | |||
QVPINGSFRVRQNGLRRPHKLIKWPFDRRVRIRTHDHRRRTVSEQCLPNHGIQVTVRRPAKRNRSNLGAHNEDASAGVVLCEVFSETENGAAGEASLLIHHESFDGGSESEELGELVIGA GHVDAGGGAEDKVGDLGFGLTPLFDGL* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,033.672 | ||
Theoretical pI: | 6.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 56.867 | ||
aromaticity | 0.048 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.279 | ||
sheet | 0.238 |