Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646426.1	internal	268	3-806(+)
Amino Acid sequence :
PSLGLLSELYWLDLADNQLKGNLPVSTANSPGLDQLLKAKHFHFNKNQLSGSIPSTLFSSKMVLIHILFDGNQLTGEIPDSIGLIKPLEVLRLDRNSLRGKVPSTLNNLTSLSELHLANN QLNGPIPNLTGMNSLNYVDLSNNSFDPSEAPAWFSTIQSLTTLVIEGGKLQGLVPQILFSFPQLQQVKLRNNQFNGTLDMGKNISQQLQIVDFEKNNISYVTLGSGYSNILILQGNPVCQ TDLSNSKFCQLQQRNLKVYSTSLASCGS
Physicochemical properties
Number of amino acids:		268
Molecular weight:		29,384.134
Theoretical pI:		7.329
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		41.352
aromaticity		0.067
GRAVY		-0.136
Secondary Structure Fraction
Helix		0.340
turn		0.340
sheet		0.235