Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646436.1 | internal | 277 | 2-832(+) |
Amino Acid sequence : | |||
KVRFDRNGPAAIAKYQADHAIPGATEDCNSVASTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPTGNEEWWPQLGLPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMS PDIAKIRKLVRQSKCLQDKMTAKESATWLSIINQEEALSRKLHPESCPPICSAGGSGSFSTSDASEYDVEGVDDDPNVEVMECKPRDIHMFNTVMVQPPPQSIKGEIINMDFIRKRKPTD EPDSMIEQKVYTCEYTRCPYSDYHLGFHDRTSRNNHQ | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 12,433.257 | ||
Theoretical pI: | 6.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 44.188 | ||
aromaticity | 0.105 | ||
GRAVY | 0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.272 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646436.1 | complete | 114 | 645-301(-) |
Amino Acid sequence : | |||
MTVLNIWISLGLHSITSTFGSSSTPSTSYSLASLVEKDPLPPAEHIGGQLSGWSFLDKASSWFMMDNQVALSLAVILSCKHFDCLTSFRILAISGDMCLITAVRTLTFHAFFRS* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,433.257 | ||
Theoretical pI: | 6.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 44.188 | ||
aromaticity | 0.105 | ||
GRAVY | 0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.272 | ||
sheet | 0.254 |