Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646448.1 | internal | 276 | 2-829(+) |
Amino Acid sequence : | |||
ILVISFSWAASSSTATERLLQCLAVPPGPAIPVYTPNNSSYNSILQSKIKMVRFASSGIPKPRLIITPLHESHVQKAVICCRKHGFQVRTRSGGHDYEGLSYTTYNDIVPFVVLDLFNLQ TISVDVEDGTAWVQVGATLAQVYYKIADKTSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNVDGKILNKDSMEEELFWAIRGGGGASFGIVLSWKIKLAPVPPTVT VFRIQRTLEEGATALVHKWQYIAHKLPKDLTIYGIV | |||
Physicochemical properties | |||
Number of amino acids: | 276 | ||
Molecular weight: | 30,060.329 | ||
Theoretical pI: | 9.072 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45630 | ||
Instability index: | 28.310 | ||
aromaticity | 0.098 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.254 | ||
sheet | 0.196 |