Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646449.1 | 3prime_partial | 231 | 96-788(+) |
Amino Acid sequence : | |||
MGNLLCCVQVDQSTVAIKERFGKFNEVLEPGCHCLPWIFGCQLAGHLSLRLQQLDVRCETKTKDNVFVNVVASVQYRALADKASDAFYKLSNTRTQIQAYVFDVIRASVPKLNLDDAFEQ KNEIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFSVNVPGTTAK | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,634.043 | ||
Theoretical pI: | 5.756 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 31.210 | ||
aromaticity | 0.065 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.169 | ||
sheet | 0.307 |