Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646461.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKA | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 28,398.182 | ||
Theoretical pI: | 9.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.133 | ||
aromaticity | 0.102 | ||
GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.289 | ||
sheet | 0.215 |