Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646466.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
QQLLSKIATNDGHSELSPYFDGWKAYDSDPFHPTKNPTGVIQMGLAENQLCFDMIEEWIKKHPDASICTDHGVHGFRDIASYQDYHGLPAFRNAVANFMGKARGGKVTFDPDHIVMSGGA TGAAETIAFCLANPGDAFLVPAPYYPAFDRDLSWRTGVQLISVDCKSSNNFKITIPALEAAYEKALASNIKVKGLLINNPSNPLGTFLDKETLRALVRFITEKNIHLICDEIYAASVFGQ TNFVSISEVVEE | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 27,690.008 | ||
Theoretical pI: | 5.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
Instability index: | 33.506 | ||
aromaticity | 0.103 | ||
GRAVY | -0.142 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.246 | ||
sheet | 0.242 |