Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646480.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
VVVVLVMAATRAIPFSASTGISSSLSKTLNPSTPLKTLPSNLGFLSSASKSLKPLLSLSSSSASSSVGSAMSSRMMVSVPAVLSSETLDFETSVFTMEKINLAGHDEYIVRGGRNLYHLL PDAFKGIKQIGVIGWGSQGPAQAQNLRDSLAEAKSDIIVKIGLRKGSRSFAEARAAGFSEENGTLGDIWETISGSDLVLLLISDAAQAENFEKIFSLMKPNSILGLSHGFLLGHLQSLGL DFPKNISVIAVCPKGMGPSVRRLYVQG | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 11,610.306 | ||
Theoretical pI: | 9.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 79.239 | ||
aromaticity | 0.087 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.327 | ||
sheet | 0.288 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646480.1 | complete | 104 | 737-423(-) |
Amino Acid sequence : | |||
MFLGKSSPRDCKCPRRNPWDSPSMLLGFMREKIFSKFSACAASEINNKTRSLPEIVSHMSPRVPFSSENPAARASAKEREPFLSPILTIMSDLASASESLKFWA* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,610.306 | ||
Theoretical pI: | 9.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 79.239 | ||
aromaticity | 0.087 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.327 | ||
sheet | 0.288 |