Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646482.1	5prime_partial	146	2-442(+)
Amino Acid sequence :
IEDFASENVVYLELRTTPKKNEAIGMSKRSYMGAVIDGLSSVDAVDVDFMPLGMKMERPKKSLSINSNGIVRRKIFVRLLLSIDRRETAEAAMETVQLALEMRDQGVVGIDLSGNPAVGE WDTFLPALNFAKEQGLPIALHCGEQM*
Physicochemical properties
Number of amino acids:		146
Molecular weight:		14,121.912
Theoretical pI:		5.458
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		35.115
aromaticity		0.097
GRAVY		-0.049
Secondary Structure Fraction
Helix		0.331
turn		0.194
sheet		0.234

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646482.1	3prime_partial	124	473-844(+)
Amino Acid sequence :
MLDFLPQRIGHAICLDDEHWRQLKASKIPVEICLTSNVQTECVSSIHDHHFIDLYNSKHPLVLCTDDPGVFSTSLCNEYHLASSAFGLGIEKVFQMGRNAIDYIFADEMVKTHLREIFSS FAHD
Physicochemical properties
Number of amino acids:		124
Molecular weight:		14,121.912
Theoretical pI:		5.458
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		35.115
aromaticity		0.097
GRAVY		-0.049
Secondary Structure Fraction
Helix		0.331
turn		0.194
sheet		0.234