Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646492.1 | internal | 135 | 1-405(+) |
Amino Acid sequence : | |||
NSDMIVTAGPLSSLKVEILVLKGYFGNDQEDWSEEAFDASVRCQREGKRPLLAGDLFVTLKDGVGFIRKITITDNSSWTRSGTFRLGARIVQGTFGADRVREARSGPFDVRDQRGQGYKK HYPPFPSDKVWRLEG | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 15,139.877 | ||
Theoretical pI: | 9.167 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 30.942 | ||
aromaticity | 0.104 | ||
GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.252 | ||
sheet | 0.185 |