Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646497.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
VIMEPAAHPSESESHPVTESASSVVPEDAPKKSYASIVKVMKGTAPTSLNAPTKSTRTAPVNVAQNSVGLAAPIPAPEPLIASSNKAPENNSVPDNDNTQEEDGYSIYIRNLPMNATPVQ VEGEFKKFGSIKPGGVQVRSNKQQGFCFGFVEFESPTSVRSALDASPINVGGRQAFVEEKRTTSRA | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 19,696.722 | ||
Theoretical pI: | 5.770 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 59.423 | ||
aromaticity | 0.054 | ||
GRAVY | -0.477 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.344 | ||
sheet | 0.226 |