Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646505.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
KDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASMQKGSTAESGNIEAENDENDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK LLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRTTGITN AVVASSLLESVESGDLIAYGLI | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 28,331.946 | ||
Theoretical pI: | 5.406 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 30.932 | ||
aromaticity | 0.053 | ||
GRAVY | -0.142 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.225 | ||
sheet | 0.263 |