Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646544.1	5prime_partial	111	2-337(+)
Amino Acid sequence :
LDFDLLSLLSKPKDYYKILELHYNATEDIIRSNYIRLALKWQPDKQKDDDGATSRFQEINEAYKVLIDPVQRMEYDKGMLHLYDHNFMEYLDRYKSLILTCNGLGIKHSLR*
Physicochemical properties
Number of amino acids:		111
Molecular weight:		13,274.033
Theoretical pI:		6.074
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18910 18910
Instability index:		32.943
aromaticity		0.117
GRAVY		-0.598
Secondary Structure Fraction
Helix		0.360
turn		0.162
sheet		0.270