Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646571.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
SSHTPKPQVIITPSHESHVQAAVICCRKHGLQIRVRSGGHDYEGLSYTSDVPFVVVDLANFESIVVDVEDRSAWVQAGATIGQVYYRIAEKTSAYGFPAGACPTVGVGGHFSAGGYGGLF RKYGLAADNIIDARIVTVDGKISDKESMGEDLFWAIRGGGGGSFGVILSWKIRLVPVPPVMTLSTVSRRLEQGATELVYK | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 21,398.077 | ||
Theoretical pI: | 6.986 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 32.304 | ||
aromaticity | 0.090 | ||
GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.265 | ||
sheet | 0.190 |